PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.04G024300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family ARF
Protein Properties Length: 786aa    MW: 87177.1 Da    PI: 6.5538
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.04G024300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.46.4e-24156257199
                          EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                          f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F  
  Manes.04G024300.1.p 156 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL- 243
                          99****************************963.3445679************************************************. PP

                          -SSSEE..EEEEE-S CS
                   B3  85 dgrsefelvvkvfrk 99 
                           + +++el+++++r+
  Manes.04G024300.1.p 244 -RGENGELRLGIRRA 257
                          .4499999****996 PP

2Auxin_resp123.41.6e-40282363182
           Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                          +a+a+st+s+F+v+Y+Pras++eFvv+++k++k++ ++v++G+Rfkm+fe++ds+err+sG+v+g sdldp+rWpnSkWr+L
  Manes.04G024300.1.p 282 VANAISTNSMFNVLYSPRASHAEFVVPYKKYMKSIMNPVCIGTRFKMRFEMDDSPERRCSGVVTGKSDLDPYRWPNSKWRCL 363
                          689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019369.03E-45147269IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.1E-41150268IPR015300DNA-binding pseudobarrel domain
CDDcd100173.61E-23154256No hitNo description
PfamPF023626.0E-22156257IPR003340B3 DNA binding domain
PROSITE profilePS5086313.211156258IPR003340B3 DNA binding domain
SMARTSM010193.2E-24156258IPR003340B3 DNA binding domain
PfamPF065072.7E-34282363IPR010525Auxin response factor
SuperFamilySSF542777.85E-10660740No hitNo description
PROSITE profilePS5174521.408661745IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MEIDLNHAVT EVEKNAFCTN GDSSSSSCSS NSSPSPASSS IYLELWHACA GPLTSLPKKG  60
NVVVYFPQGH LEQVAYSAPF SPVEMPTFNL HPQIFCKVVN VQLLANKEND EVYTQLALLP  120
QPELVGQKLE GKELEDLGVD EEGGAGLPAK STPHMFCKTL TASDTSTHGG FSVPRRAAED  180
CFPPLDYKQQ RPSQELVAKD LHGVEWRFRH IYRGQPRRHL LTTGWSIFVS QKNLVSGDAV  240
LFLRGENGEL RLGIRRAARP RNVLPDSVIG KQNSYPSVLS PVANAISTNS MFNVLYSPRA  300
SHAEFVVPYK KYMKSIMNPV CIGTRFKMRF EMDDSPERRC SGVVTGKSDL DPYRWPNSKW  360
RCLMVRWDED IGSDHQERVS PWEIDPSVSL PPLSIQSSPR LKKLRTGLPA MPPDNPITGG  420
GEFLDFEESG RSSKVLQGQE NVGFVSPLYR GDTLNRSPDF EMQNLAHQNL VSIGREKANI  480
GEITRARSTT YTGFAESDRF PKVLQGQEIC QLRSLTGKSD FNLGAWGKPN LGFGPFNIYQ  540
APRANFYPLA AESLQNMYFH YGDIYKTGQD PRMRSYATNF PRENFQFGAS SMLTARDEVG  600
KSNQSHEHKP QETISATPAL GVNLINQEDN SFNGTSSGCK LFGFSLTAES AIPNSQNSGK  660
RSCTKVHKQG SLVGRAIDLA RLNSYSDLLV ELERLFSMEG LLRNPNKGWQ ILYTDSENDV  720
MVVGDDPWHE FCNVVSKIHI YTQEEVEKMT IGVIGDDTQS CLDQAHAVME ASKSSSVGQP  780
DFSPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-122273862354Auxin response factor 1
4ldy_B1e-122273862354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012064855.10.0PREDICTED: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A067LHL50.0A0A067LHL5_JATCU; Auxin response factor
STRINGVIT_06s0004g03130.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52363252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4